Description
Tesamorelin is a synthetic peptide related to GHRH and has authorised medical uses in specific jurisdictions and indications. A product’s identity, approval status and lawful intended use must be verified independently.
Technical Specifications
- Product Name: Tesamorelin
- Peptide Classification: Stabilized GHRH Analog, as labelled
- Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂, as printed in the supplied artwork
- Molecular Weight: Approximately 5,135.9 Da
- Purity: ≥98% HPLC, as stated on the supplied label
- Form: Lyophilized powder
- Appearance: White to off-white, as labelled
- CAS Number: 218949-48-5
- Labelled Pack: 2 mg/vial; 1 vial
Quality Documentation
Use the applicable certificate of analysis and manufacturing documentation to substantiate product identity, quality and regulatory status.
Storage and Handling
Refer to the validated instructions for the actual product presentation.
*Notice:* Do not imply that this product is an authorised medicine for every indication or market. Avoid unsupported fat-loss or bodybuilding claims.
Reviews
There are no reviews yet.